PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco015382.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family WOX
Protein Properties Length: 217aa    MW: 25417 Da    PI: 6.4052
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco015382.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.43.2e-201374157
                 TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 ++ R+++t+eq+++L elF+   r+p+++++++++++l    +++ ++V++WFqN++a+e++
  Aco015382.1 13 KCGRWNPTAEQVKVLTELFRAgLRTPTTDQIQRISTHLssfgKIESKNVFYWFQNHKARERH 74
                 568*****************99**************************************95 PP

2Wus_type_Homeobox111.54.5e-361475364
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       + RW+Pt+eQ+k+L+el+++GlrtP++++iqri+++L+++Gkie+kNVfyWFQN+kaRer++
        Aco015382.1 14 CGRWNPTAEQVKVLTELFRAGLRTPTTDQIQRISTHLSSFGKIESKNVFYWFQNHKARERHH 75
                       78**********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.1391075IPR001356Homeobox domain
SMARTSM003890.00311279IPR001356Homeobox domain
PfamPF000462.1E-171474IPR001356Homeobox domain
SuperFamilySSF466894.38E-111577IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-71673IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010078Biological Processmaintenance of root meristem identity
GO:1902459Biological Processpositive regulation of stem cell population maintenance
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MEDDQAAGRA GVKCGRWNPT AEQVKVLTEL FRAGLRTPTT DQIQRISTHL SSFGKIESKN  60
VFYWFQNHKA RERHHHYHRR HPHHRHHHHH LKKRRRGASP ALDDDDDDDD DDDDDDETTT  120
LLLLMPPETK RDQPSRTNYN HRLFIPSYAN ADQEAISWEQ PKREIETLEL FPLKSYDLQE  180
AHEKLRYVRS GADCTDISFF DTESDPPLEL RLSSFL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0383313e-73KF038331.1 Triticum aestivum wuschel-related homeobox protein (WOX5c) mRNA, complete cds.
GenBankKF0383463e-73KF038346.1 Aegilops tauschii isolate AS2386 wuschel-related homeobox protein (WOX5) mRNA, complete cds.
GenBankKF0383473e-73KF038347.1 Aegilops tauschii isolate AS2393 wuschel-related homeobox protein (WOX5) mRNA, complete cds.
GenBankKF0383483e-73KF038348.1 Aegilops tauschii isolate AS2395 wuschel-related homeobox protein (WOX5) mRNA, complete cds.
GenBankKF0383493e-73KF038349.1 Aegilops tauschii isolate AS2399 wuschel-related homeobox protein (WOX5) mRNA, complete cds.
GenBankKF0383503e-73KF038350.1 Aegilops tauschii isolate AS2404 wuschel-related homeobox protein (WOX5) mRNA, complete cds.
GenBankKF0383513e-73KF038351.1 Aegilops tauschii isolate AS2407 wuschel-related homeobox protein (WOX5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642985.13e-78PREDICTED: WUSCHEL-related homeobox 9
SwissprotQ8W0F14e-80WOX9_ORYSJ; WUSCHEL-related homeobox 9
TrEMBLA0A0E0JR661e-78A0A0E0JR66_ORYPU; Uncharacterized protein
STRINGLOC_Os01g63510.19e-78(Oryza sativa Japonica Group)
STRINGBGIOSGA000469-PA9e-78(Oryza sativa Indica Group)
STRINGORGLA01G0314800.19e-78(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP94113643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.13e-32WUSCHEL related homeobox 5